SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|137112|e_gw1.155.27.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|137112|e_gw1.155.27.1
Domain Number 1 Region: 2763-3044
Classification Level Classification E-value
Superfamily BEACH domain 5.62e-122
Family BEACH domain 0.000000016
Further Details:      
 
Domain Number 2 Region: 3098-3307,3338-3373
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.18e-33
Family WD40-repeat 0.0032
Further Details:      
 
Domain Number 3 Region: 2567-2610,2679-2731
Classification Level Classification E-value
Superfamily PH domain-like 4.49e-18
Family PreBEACH PH-like domain 0.052
Further Details:      
 
Domain Number 4 Region: 928-1110
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000056
Family Clostridium neurotoxins, the second last domain 0.075
Further Details:      
 
Domain Number 5 Region: 412-441,479-655,775-838
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000165
Family GUN4-associated domain 0.084
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|137112|e_gw1.155.27.1
Domain Number - Region: 110-248,394-441
Classification Level Classification E-value
Superfamily ARM repeat 0.000609
Family HspBP1 domain 0.078
Further Details:      
 
Domain Number - Region: 1236-1292,1397-1536,1567-1609
Classification Level Classification E-value
Superfamily ARM repeat 0.0192
Family HspBP1 domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|137112|e_gw1.155.27.1
Sequence length 3416
Sequence
ESEQDFKRFWEEFRCGHSDKEKQEALEMALSVFCKLSRRHQNPAQLATSLVDTRQFAFVV
ARAFIADVDKIKSSTSQDTLAKSLIQGKQVPPTVSPIEKTANMLYVLESLVSPPLDVQPL
LDAGLLSCLVHVLYSFLDLTDDFTKAPGNALGISTFLTESVLQVEGEVVHILKALGSHLG
AAQSLADDDSLQMLFAMVIQRPSSVHLAQLHRHVLQILGNVLSSDDGSCAHYIHRHQLVK
MLLRPVKEFTCESGDGTLTVGVVSLLLTCVEVSCRPGAGGINLREDLQNAHGYQLLVQFG
LSLASPATADASASSSLGRLLSLQDSGEETSSGQADLSTSFLALLDTLIDLAQVGPVEES
EPGDLNYNKAKAVAIQSRCFPIFDGTRFKSNESLTDGKVRDLFAVQVLQDIFLKSGNLNS
QVEVLDRLLRLLASHMDNYLVVQELRTLSLFILNMPALPRVLQGQLLKVLEHVVTVVNQV
PEQELLSLCCLLQQSLSQSLRSSVLSFLVKILSFDPQYKKVLREVGVLDLLVEDLKTAAK
ISQKKDGQAVHIFEDKVSLAQGWDCLLSLLKRNEANQTAFRKAHGFDALQPLLLSDIHRT
YVLRVLSCLISEDTVQSHPEELKALLGTTRAGQGQGISFKAKTDILWAVFRILCSNPAAK
DVFGEGKGFTLMHTVLESLEDFSGAEPRQRMEIVNALLHVVTVGVAGHSVNRIRLNDCVL
SHAFSAALLKTGLICGDYEDLILDLFFDICLEKVQSPARNVDSFRAGTWDNEFISVDERR
ELFNAGLVQVALQLFDDFSPKAQLKVVTSVEALSEGSLVNKDRLTLAGCLKMVLEILTPS
ASYSPAIWMHGMQIVKLLGSYRISSFELRALLRYMWQCRDYTYGQVAQRYIEALEGVVHS
EESSAEISPAARFMDFSSRRNGHASVRISLGDRSWPPAAGYSFMCWLRFTGIEGKTKGGR
SRPALRIFMVESVEEKGTVLAELYLNDSGLLTLATGPSSLLAFKGVRLEEGLWYHIVIVH
NKPNALAGLFQSSVASLYVNGNLRHTGKLGYSPSSFGKTIQAVIGIPPQLSDVSSSTWQM
TGCYLFEEVLPSQAVCLVYALGRGYRGLFQDTDLLRFVPYEACGGGNLAVLEGLETASAG
VNVQKGGDAAKYRIDGSGAVWELERLVSFWIQLSNKKLIFSFDGTPGQTQTAGQQSIVNL
VEPLSAAASPLGGLPRIGRLVGDVEILNPCSFGDSMRKVGGMAVVLALVEAAETGEMLHL
ALSLLVRVLYYNPRNTYDMLACRGYHLLVLFLHRRIRLFEVQDLELLFQIAACEASFYAP
PQSSHFATNTASSGQHPLIDMHGANNNNNVNGPPADDQVSSGGSVFDATDIGPEDIANGM
SEFGSAATPEESLNCVVLSNPDMMEHVLMDWTLWSRASVPIQLSLLGFIERLVAVHRYRN
HNLATLRRLNIVQHLLVTLQRGDIEVPVIEKLVVLLGILLEDGFLPSELKYVADFVVMSF
NPPEVVRDSPISREAMGLQVIVRNVLLEMLIDLQMTINAEDVLETWHKTVSSRIITFVLD
EAAHPTTMRWIMTLLGVCISSSPTFSTKFRASGGYQAISHVLSSFYDAPEIYYILFCLMF
GKPVYPRQPEVRLLDFHALMPGEAIEGEILFTEFLDSILLMFKAAFDKMSLQSQIVQQTG
DFSQFPESLAAGFANGFKDIGGDLQSEALLHKTYAARLMGGEAAAPSLVTSLLRFMVDLA
KMHRPFSTACRRLDFLEGSVELYFSCARSAAAIEAAQGISAEANNQSSYKFSDDFQVINQ
KVGAKADAEEPAAQEVELLAVPTKSSPIDIMRPFQADESIDNFFVFPSTYAENTTNGDDT
HSQRSSSFSNAFTESSTSAFVTLPLSPTTSDNSRNEAGTPLPSRTPGNNLASWVKSTFPS
DTPAPSRSASSIPSRTTSIVSASTHGPASDSDRSSIQDDKQAFPITKKLLLQLESAGSGG
GPCSSGATAVLDLVAEVLADALADQLKATPLVEATLEAVPLHIGGDIAVVFQGLCLYRVM
NFLERRLQRDDEEAHKKLDRARWSSNLDAFSSLVVDRVYMGAFSDSAGVLKVLEFLLSML
QLANKHGRVEEAMTTGRSLLSLARGGFKQLEPFVQSLLRNTNRMLLFCFLPSPTTNEELT
SSNTGLLAKGGLDITLVLQLLISHKKLVLCPGNVDSEFLQCLLVNIVPLLQDPRQAVRTL
AVDACKVLLHYRKEALEDILVLRHASGEALDVFHGGFDKLLASNSIGFYTWFDDAHDAIG
RVLEQRASLAWMQFIGGAARFNSSRLKNFEVRRKREMGRRMKDASKADGRHWEQMLERRV
ALDMVRDSLSAELRLMRQVKYGWVIHAENEWQDHIQQLMHERGLWPVVKPVAESDNEWQL
CSTEGPYRMRKKLVRCKPKIDIAAHPPEEAEAEVLPNGQAGFAVDIENPDYDSFFHIFSL
GIDSPKKNAAKDYLESFDEEDTESKGREDDANSLSTRGDGTIERSRSAINDSGKSPESIQ
RSKSDAHGTAPGSSPTKAGDFQLDDADDQDFQDDGEYLIAPYLERGEKIRFRYNCERVAG
LDKHDGIFLIGERCLYIIENYFIDSAGRICEKGGEGELSVIDQALGVKTSISVVFESTQT
ATWSDTENTWPGGKAWACSGGAWGKEKLSSGRQMPHSWRMWKLDSVHELLKRWYQLRPVA
IELFSMDGCNDLLVFHKEERDEVFKNLLSINLPRSSRLETAISGVSKLDSNEGGRLFKTM
AKSFSKRWQNGEISNFQYLMHLNTLAGRGYNDLTQYPVFPWVLADYESEELNLSNPTVYR
RLDKPMGALSLEREDVFRKRYDNWDDPEIPKFHYGSHYSSAGTVLFYLIRLPPFSQENLK
LQGGQFDHADRLFTNIRDTWLSASQGNTADVKELVPEFFYLPEFLENKFDLDLGTKQSGE
KVDDVVLPPWAKGSAREFIRKHREALESQYVSENLHHWIDLIFGYRQRGQAAVDATNVFY
YLTYEGAVDIDSVRDPALKASTLAQINHFGQTPRQLFLKPHPGRKCQQKVPFGHVLRSSQ
LLAPQEIRNATTSIAQIVVSHDKVFSVGHNRLLKPRSYSKYIAWGFPDNSLRFVSYDQDR
LLSTHEGLHDGTIVCAGFSRDGRTLVTGGEDGVASVWRLRKDGVRNQRRLHLQRALCAHS
DSVTCLSVCQPYNLVVTGSSDCTVIFWDLSTLEFVRQLPQLPAPASAVHTNEMTGEIVTA
AGTMLVVWSVNGDCLAALNVSRLASEAIVSITSPVLSDWMETGWYVTGHQNGAIKLWRID
YASFAQGPSRRSRGVPPPRNVCFTGGTPEYHLVLHKVLKSHTQPVTALHLSPDLKQLYSG
DAGGHVTSWVLSTLDGSSVQVKLSYQYADSFQVSQAPALFLVCSPRHARGARMSWT
Download sequence
Identical sequences D8TCV2
jgi|Selmo1|137112|e_gw1.155.27.1 XP_002993431.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]