SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|143637|estExt_Genewise1.C_61124 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|143637|estExt_Genewise1.C_61124
Domain Number 1 Region: 6-182
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.57e-67
Family Inorganic pyrophosphatase 0.00000569
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|143637|estExt_Genewise1.C_61124
Sequence length 187
Sequence
MADRFVAAHPWHDLEIGSGAPSVFNCVVEIAKGSKVKYELDKQSGLIKVDRVLYSSVVYP
HNYGFVPRTLCEDNDPLDVLVIMQEPVLPGAFLRAKAIGLMPMIDQGEKDDKIIAVCADD
PEYKHCTDIKQLPPHRLAEIRRFFEDYKKNENKQVEVEDFLPAEKAIEAVRNSMDLYAAY
VVETLRQ
Download sequence
Identical sequences D8R4K3
jgi|Selmo1|143637|estExt_Genewise1.C_61124 XP_002966068.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]