SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|145424|estExt_Genewise1.C_100334 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|145424|estExt_Genewise1.C_100334
Domain Number 1 Region: 146-275
Classification Level Classification E-value
Superfamily SET domain 1.96e-19
Family Histone lysine methyltransferases 0.014
Further Details:      
 
Domain Number 2 Region: 1-27
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000182
Family PHD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|145424|estExt_Genewise1.C_100334
Sequence length 286
Sequence
MYCLSPILVAVPKGDWFCPHCSKDRQQVKVFPMVQRKLIDFFGIEKVEEEPTKEVRRRRH
SGSLVIYKKSRKLLPYMPSKDPSQRLEQMASLASALMTSGIEFSNELTYLPGLAPRRANR
AVLEKGGMQVIGKEDKATYELCKAMCIRGEHPPLMVTRDPRQGFVVEANNHIKDMTLIAE
YTGDVDFMCNREDDEGDSIMGLLFPEDASQELVICPDKRGNIARFISGINNHTSDGRKKQ
NLRCIRFDIDGEVHALLVSIRDIAKGERLYYDYNAYQKEYPTEHFE
Download sequence
Identical sequences D8RAW7
jgi|Selmo1|145424|estExt_Genewise1.C_100334 XP_002968131.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]