SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|146206|estExt_Genewise1.C_120071 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|146206|estExt_Genewise1.C_120071
Domain Number 1 Region: 160-334
Classification Level Classification E-value
Superfamily Bet v1-like 2.33e-34
Family STAR domain 0.0043
Further Details:      
 
Domain Number 2 Region: 6-135
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000504
Family Pleckstrin-homology domain (PH domain) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|146206|estExt_Genewise1.C_120071
Sequence length 722
Sequence
MDSTKIEGWLYVIQPHRLRIRFPRKRYFVLEGRQATCYKSKPIHDGEKQSLKKGVIQPYT
KVVDNGRENIHGQVLHTFTLSDPSFDQQQMKLAARTAEEAAKWMSAFRDAASSQAPLRQN
LAVPKRKPYFRFFERGREGGQEVPDWTGFWTSMREQGDVIAESPWKILGCKNGLRLFRES
SKSKGRFTSKFADDHPAIMAVGVVKAPCESVFDTVMALGDSRAEWDFCYSTGRIVERIDG
HTDIVHKQLRRKWLPGHMRGRDLLFHRYWRREYDGSYVILYRSVSRKDCPTRSGTVRAKL
KSGGYVISPLTGEGEQPARSLVRHMLEIDWNTWKSHFKPSRVQKITLRMLERIAGLRELY
KAKVIEPTWVDASREFDDQAAKEEKEENEERAIVVSDQEPKSAHIDEQESFLRVNDTDEF
FDAPDDSDQEDLPDDMLRSVSETEGTEEFEPETKSTASFVKRIHALAAAAHKKGAQPQTE
FSSRDAELLDREGTLPKSSFYCSWSAADPSTFLIRGKNYLRDNKKVKAKETLMQLVAVDW
FTSNQREDHIASRENTFMQPKVRKLGRSFFFIVNLQVPGSPTYSLVFYYMLKQSLDQIPL
LEKFVNGGDRFRSSTFKLIPHVAEGSWIVKQSVGKTACLIGEALDLHYFHGKNYLELDVD
VGASSVARGVVSLVFGYMSKLVVEMAFLIQANTEEDLPEMLLGTCRVSSLDVSKAVQLNP
SA
Download sequence
Identical sequences D8RDQ7
jgi|Selmo1|146206|estExt_Genewise1.C_120071 XP_002969204.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]