SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|153581|estExt_Genewise1.C_420470 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|153581|estExt_Genewise1.C_420470
Domain Number 1 Region: 187-394,423-459
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.4e-28
Family Phospholipase D 0.046
Further Details:      
 
Domain Number 2 Region: 528-630,673-755
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.89e-26
Family Nuclease 0.074
Further Details:      
 
Domain Number 3 Region: 16-173
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.26e-22
Family Synaptotagmin-like (S variant) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|153581|estExt_Genewise1.C_420470
Sequence length 834
Sequence
MEDVSLGASSPKVCLLYGTVELEIIEAKSLPNMDWFSERASQCFSILGGLQTMCAKPKDK
LAHHRHKITSDPYVVFSLGDAILAKTKVISNSQIPHWGERFQLHVAHSVPEVLLTVKDND
VFGAQVIGGVKIPAHRIASGPAIVETWFDVVGSGGKPVKQGAQLKISIKYTPVEQDKNYQ
HGVGAEGAVPRTYFPLRKGCSVKLYQDAHCPDGGLPEITLEGGGAYEHGKCWEDICQAIL
EAHHLVYIAGWSVFHKVKIVREPENHKKFSNDIANLTLGELLKRKAAEGVRVLLLVWDDK
TSHHTPLFTTEGVMGTYDEETKKFFRHSAVRCVLSPRYGDSKMSWLKQRVVGTFYTHHQK
LVIVDSQGRGNNRKLTSFIGGLDLAQGRYDTPEHPLFKTLGSIHRDDYHNPTFTGTIDHG
GPRQPWHDLHCRIDGPAAYDVLTNFAQRWRKAATWHEDAMIEIDRISWILSPNDGDQALM
VTELNDPETWNVQVFRSIDSGSVKGFPKEPADCQKQNLVTLKNVAIDTSIHTAYVERIRS
AQHFIYIENQYFLGSSYAWPDYKKGGATHMIPMELALKVASKIRSGDPFAVYVVIPMWPE
GVPDSATVQEILYFQSQTMKMMYKIIAQALNEVGSGNHPTDYLNFYCLANREERSEPGTM
APAEKSTQWYAQKYKRFMIYIHSKGMIVDDEYVIIGSANINQRSMDGSRDTELAMGAYQP
HYTWAHKKHSHPFGQVYGYRASLWAEHLGDFDPALFNDPSDIRCVHKVNEIAQGNWKQFV
SEEPSDMKGHLMSYPMSVQVNGEIKPIAGNESFPDVAGQVLGQHSINLPDNLTG
Download sequence
Identical sequences D8S963
jgi|Selmo1|153581|estExt_Genewise1.C_420470 XP_002979744.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]