SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|163731|estExt_Genewise1Plus.C_00649 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|163731|estExt_Genewise1Plus.C_00649
Domain Number 1 Region: 66-274
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.6e-24
Family BAR domain 0.028
Further Details:      
 
Domain Number 2 Region: 327-388
Classification Level Classification E-value
Superfamily SH3-domain 5.78e-17
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|163731|estExt_Genewise1Plus.C_00649
Sequence length 396
Sequence
MDAIRKQASKFREQVAKQQQARFHPGLGDLLTIWIGGSQAVFKQFSQGYGGSQGTDIVTN
EAEQQRHQQLERLFISTRAGKHFQREIVRGTEGLISTGSKQLDVSTKLAEDCRKYAAEGP
APNGALAKSATYFGNARLNIEKERDSMHRALGTQVAEPLRAMVMGAPLEDARHLAQRYDR
LRQEAEAQGQEVTRRRSKETGLNADNALKLQMAESKLTELMAAMTELGKEAAAAMTAVEA
QQQRLTLQRLIAMVEAERAYHQRVTDILDKLHTQASCDMVAERLQGESGASQQLEHSTSP
PPYEEVKENGGYSNVYQSNSDRKSSFFLAEVMHPFEAESEGELTIAVGDYVVVRQVSTTG
WSEGECRGKAGWFPSAYVERRQRVPASKVSNDRSSP
Download sequence
Identical sequences D8QQ69
XP_002960199.1.77236 jgi|Selmo1|163731|estExt_Genewise1Plus.C_00649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]