SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|164063|estExt_Genewise1Plus.C_01471 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|164063|estExt_Genewise1Plus.C_01471
Domain Number 1 Region: 33-373
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-85
Family Protein kinases, catalytic subunit 0.00000027
Further Details:      
 
Domain Number 2 Region: 296-316,374-487
Classification Level Classification E-value
Superfamily PH domain-like 5.84e-28
Family Pleckstrin-homology domain (PH domain) 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|164063|estExt_Genewise1Plus.C_01471
Sequence length 489
Sequence
MAAGEEECAPSTASSCKPGSKLTFRAPQQPYTYQDFAYGRLLGMGSYSKVVRAKKKDSGA
EFALKIMDKKHITKENKVAYVKMERLILDHLDHPGVVRLFFTFQDTHNLYMGLECCHGGE
LFDQIRRKGRLSLEEARFYAAEIVDVLEYIHGQGLIHRDLKPENLLLTADGHIKVADFGS
AKVTTPLQNGLSDAQADDKSCTFVGTAEYVSPEVLNGHPVTIGADLWALGCIIYQMLEGR
PPFKGGSEYLTFQKVLAKDLVIPSHFPSAAKELINKLLNLEPDKRPGAGPAGYTALKSHA
FFSGIEWLKLRQSAAPGLAPSPSSQGGGNGAESDDSENSDWDLAHLGGRVSRLDVSDASS
PMSSSNEPSSPSAVLASAARLLDENVHEPWQKFLFEGETILASSRVRKFRKLSVKKRQLI
LTDRPRLFYVHPIKLVFKGEVPWSRDIYVRVENDLKFCICTPKRTYNLEDTKGQARVWKE
SIEKLVNAK
Download sequence
Identical sequences D8QMJ5
jgi|Selmo1|164063|estExt_Genewise1Plus.C_01471 XP_002960408.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]