SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|165360|estExt_Genewise1Plus.C_20165 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|165360|estExt_Genewise1Plus.C_20165
Domain Number 1 Region: 28-158
Classification Level Classification E-value
Superfamily PH domain-like 6.92e-41
Family Ran-binding domain 0.0000434
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|165360|estExt_Genewise1Plus.C_20165
Sequence length 216
Sequence
MADREDEETVAAAEEHGAGAGEEEDTGAQIAPIVRLEEVAVKTGEENEEVLLDMKARLYR
YDQVWKERGTGVIKILKDKETNKTRVLMRQNKTLKICANHYLVPGMTLQEHAGSDKTWVW
HAMDYSDGEVKKELLCVRFGSVENAQRFKDIYVERTEEQGEKKATEEESKEESKVAETLE
KLSVKDLSSDPVKPAANDDEKEKPAVDDVKADGKKE
Download sequence
Identical sequences D8QU73
XP_002962786.1.77236 jgi|Selmo1|165360|estExt_Genewise1Plus.C_20165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]