SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|165923|estExt_Genewise1Plus.C_30365 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|165923|estExt_Genewise1Plus.C_30365
Domain Number 1 Region: 170-375,404-433
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.65e-31
Family Phospholipase D 0.053
Further Details:      
 
Domain Number 2 Region: 487-602,650-735
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 9.42e-30
Family Nuclease 0.088
Further Details:      
 
Domain Number 3 Region: 6-153
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-18
Family Synaptotagmin-like (S variant) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|165923|estExt_Genewise1Plus.C_30365
Sequence length 804
Sequence
MAQILLHGTLHITVYEAASLVNENRVSGASPKFMRKMVEGVEDSIGIGKGVSSLYATIDL
ERQRVGRTRLIRKEPTKPVWNESFHIQCAHNIANVVVSVKDDLAVSAFLLGRAKVPVKRI
MYGELVEGWFELYNDSGKKLGNSRVRLRLQFFDITRDPRWGRGLVDGTKFPGVPFTYFPQ
RKGCKVTLYQDAHMTDNFLPKIYLHGNAVREPTRCWEDVYEAIANAQHFIYITGWSVYAE
ITLIRDSARPVHGGLNVKLGDLLKKKADQGVRVLMLVWDDRTSMSVVKMEGLMATHDQET
LNFFYGSKVKCLLCPRTPDSGLSYVKGFQIGTMFTHHQKTIIVDAPGRSHQQRRVLSFVG
GLDLCDGRYDTQFHSLFRTLGTVHKEDFHQPNYAGASIDKGGPREPWHDIHSKLEGPVAW
DVLRNFEQRWHKQGDGNQHLVSLGNLEPQSSLVADEHDENTWNVQLFRSIDGGAAADFPE
SPEAAAAAGLVSGKDSTIDRSIQDAYIHAIRRAKDYIYIENQYFLGSSFAWESDHDAEAH
HVIPRELALKIVSKIEAGERFSVYVVLPMWPEGVPESGQVLAILDWQKKTMQMMYKAIAQ
ALDAQGIRGVSPRDYLAFYCLGNRERRLGGEFLPLSTPDANSAGYRSAQENRRFMIYVHS
KMMIVDDEYIIVGSANINQRSMDGGRDTEIAMGAYQPLRTWPTRGQIHGFRMSLWYEHMG
QLDDLFLRPSSLECMRKVNRTADQLWHMYAADEMVDLPGHLLAYPVGIASDGSVAELPGC
AKFLDTDAKILGVKSDVLPPILTT
Download sequence
Identical sequences D8QXW1
XP_002963233.1.77236 jgi|Selmo1|165923|estExt_Genewise1Plus.C_30365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]