SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|167898|estExt_Genewise1Plus.C_60982 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|167898|estExt_Genewise1Plus.C_60982
Domain Number 1 Region: 27-206
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 5.36e-70
Family Inorganic pyrophosphatase 0.00000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|167898|estExt_Genewise1Plus.C_60982
Sequence length 212
Sequence
MSTPNGPIANSGSAKSPLNKRILSSLSRRSVAAHPWHDLEIGPGAPAVFNCVVEISKGGK
VKYELDKKSGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRA
RAIGLMPMIDQGEKDDKIIAVCADDPEFTHYQDIKDLPPHRLAEIRRFFEDYKKNENKTV
AVNDFLPAENAVQAIQHSMDLYASYIVESLRQ
Download sequence
Identical sequences D8R4C4
jgi|Selmo1|147848|estExt_Genewise1.C_170370 jgi|Selmo1|167898|estExt_Genewise1Plus.C_60982 XP_002966020.1.77236 XP_002971470.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]