SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|169402|estExt_Genewise1Plus.C_90576 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|169402|estExt_Genewise1Plus.C_90576
Domain Number 1 Region: 23-123
Classification Level Classification E-value
Superfamily PH domain-like 2.1e-30
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|169402|estExt_Genewise1Plus.C_90576
Sequence length 137
Sequence
MAGIAGFFTRKEPAEENQVPFWSNPERAGWLMKQGEYIKTWRRRWFVLKQGRLFWFKEST
ITQYSRPRGVILVSGCLTVKGAEDVLNRQHAFELSTNKETMYFIADSDKEKEDWINSIGR
SIVRHSRSITETEVLDY
Download sequence
Identical sequences D8RAA6
XP_002967688.1.77236 jgi|Selmo1|169402|estExt_Genewise1Plus.C_90576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]