SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|170833|estExt_Genewise1Plus.C_120747 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|170833|estExt_Genewise1Plus.C_120747
Domain Number 1 Region: 215-402,451-490
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.32e-69
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0000025
Further Details:      
 
Domain Number 2 Region: 27-239
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.02e-52
Family Tyrosyl-DNA phosphodiesterase TDP1 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|170833|estExt_Genewise1Plus.C_120747
Sequence length 491
Sequence
MATTVHSKNTRGGEPENSKMLQSSRSPCGFQLLRVQGLPDWANAGCVRISDVIKGDVLVA
ILSNYMVDIEWLLSACPLLRSIPQVVMIHGESNVSQLQSVKPSNWLLFKPRLWISYGTHH
SKAMLLVYPTGVRVVVHTANLINIDWNNKTQGLWMQDFPLKSMTGITTASDFENDLVDYL
TALEWSGCTVDVQHHGQMKINASYFRNFDFSNAAVRLIGSIPGYHSGPQLNKWGHMKLRS
ILKEEKFDKKFQNSPLVYQFSSLGSLDEKWMEEFSSSLSEGSTLDGRRLGLGEAQIIFPT
VEDVRQSLEGYRAGAAIPSPAKNVEKPLLKKYWSRWQAEHTGRSRAMPHIKTFVRFRENA
LAWVCLTSSNLSKAAWGALQKNKTQLMIRSYELGVVFLPSMLSKFKNRYSCTEDLPLINE
NEACKTGAPNVKLYTLAATESMDEEEDTNAKIIRLPLPYALPPPRYSSQDEPWKWDKQYL
HPDVYGKRWPN
Download sequence
Identical sequences D8RES1
XP_002969401.1.77236 jgi|Selmo1|170833|estExt_Genewise1Plus.C_120747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]