SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|172131|estExt_Genewise1Plus.C_170226 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|172131|estExt_Genewise1Plus.C_170226
Domain Number 1 Region: 50-210
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 5.49e-61
Family Inorganic pyrophosphatase 0.00000928
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|172131|estExt_Genewise1Plus.C_170226
Sequence length 215
Sequence
MADRFVAAHPWHDLEIGTLVSCSLDSQAVLAIFSRDRASCFVAKPQALLESVFQVVEIAK
GSKVKYELDKQSGLIKVDRVLYSSVVYPHNYGFVPRTLCEDNDPLDVLVIMQEPVLPGAF
LRAKAIGLMPMIDQGEKDDKIIAVCADDPEYKHCTDIKQLPPHRLAEIRRFFEDYKKNEN
KQVEVEDFLPAEKAIEAVRNSMDLYAAYVVETLRQ
Download sequence
Identical sequences D8RK47
jgi|Selmo1|172131|estExt_Genewise1Plus.C_170226 XP_002971422.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]