SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|186850|estExt_Genewise1Plus.C_1370045 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|186850|estExt_Genewise1Plus.C_1370045
Domain Number 1 Region: 158-367,396-434
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.98e-30
Family Nuclease 0.068
Further Details:      
 
Domain Number 2 Region: 496-596,644-731
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.33e-27
Family Polyphosphate kinase C-terminal domain 0.083
Further Details:      
 
Domain Number 3 Region: 6-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000145
Family PLC-like (P variant) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|186850|estExt_Genewise1Plus.C_1370045
Sequence length 801
Sequence
MAFILLHGTLHATIYEASDLEHDHSAGGFFNKIIGGITGDGSHKFYATVDLEKTRVGRTR
MIGKGESWNESFHIYCAHNVSKVVVTIKDDKAIGAVLLGRASIEVSELLSGETVENWYDL
YDDNGEKRGDSKVRIKLQFHEATNDPRFGRGLCDGRKFQGVPFTYCQQRKGCKVTLYQDA
HMTENFLPDIKLAGGGKHAETRCWEDVFEALTNAKHLIYITGWSVYTEIKLIRDPERQIP
GSSGVTLGELLKRKAEEGVRVLMLVWDDRTSIPIVRMDGLMATHDQETLDYFRGTQVKCL
LCPRNPDDGLSVVQEFQIGTMFTHHQKTIIVDSPLPGAQGDSQQRRIVSFVGGIDLCDGR
YDNQYHSLFRTLDSYHGDDFHQPNFQTASIKKGGPREPWHDIHSKLEGPVAWDVLHNFEQ
RWLKQADEKDLLLPIREVSDIEPPAEVTFRDDPSTWNVQLFRSIDGGAAANFPEDPELAA
KAGLVSGKDSTIDRSIQDAYIHAIRRAKDFIYIENQYFLGSSFAWDTDTDAGAYHLIARE
LALKVVNKIEQGERFVIYVVVPMWPEGLPESGQVLAILDWQKKTLDMMYRSIAQALDAKG
ITDESPKDYLTFFCLGNRETPQDGDYVPPEAIEEEATNYKAAQEHRRFMIYVHSKMMIVD
DEYIIVGSANINQRSMDGGRDTEIAMGAYQPFHTCHHHAPRGDVHGFRMSLWYEHLGKLD
NAYLHPSSLECVRKVNELADEYWAMFAGEEVVDLPGHLLSYPIGITTTGEVCELPGRSQF
PDTKANILGAKSDVLPPILTS
Download sequence
Identical sequences D8TAE8
jgi|Selmo1|186850|estExt_Genewise1Plus.C_1370045 XP_002992572.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]