SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|18801|gw1.16.247.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|18801|gw1.16.247.1
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000182
Family alpha-D-mannose-specific plant lectins 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|18801|gw1.16.247.1
Sequence length 96
Sequence
YVFLVQKDCNAVYYYKNIAIWNTETYGMSFDCKFRLQEDGNFVLYSAFDLKPLYATETYC
KKFNCVKPSMLILQLDCNLVLYEDGKPSISMWSTKT
Download sequence
Identical sequences D8RJQ9
XP_002971162.1.77236 jgi|Selmo1|18801|gw1.16.247.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]