SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|232336|fgenesh1_pm.C_scaffold_24000083 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|232336|fgenesh1_pm.C_scaffold_24000083
Domain Number 1 Region: 6-241,290-315
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.49e-66
Family BAR domain 0.00067
Further Details:      
 
Domain Number 2 Region: 459-550
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.35e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.00035
Further Details:      
 
Domain Number 3 Region: 282-399
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-26
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 
Domain Number 4 Region: 643-665,695-749
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.95e-17
Family Ankyrin repeat 0.0024
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|232336|fgenesh1_pm.C_scaffold_24000083
Domain Number - Region: 589-622
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.0288
Family Pyk2-associated protein beta ARF-GAP domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|232336|fgenesh1_pm.C_scaffold_24000083
Sequence length 750
Sequence
MHFSKLEDSPMFRKQIQALEESAEALRERCQKFFKGSRKYTEGLGEAYDGDIAFASALET
FGGGHDDPISVAVGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLVQFASIDLQDVKD
VRKRFDKASLHYDQVREKFLSLRKDAKSDVVADAEEDLRTARTLFEQARFNLVTALSNIE
AKKKFEFLEAVSGSMDAHLRYFKQGYELLHQMEPYIHQVLTYAQQSRERANYEQAALADR
MQEYRRQMERETQNASSEHDVISAADGIQAIGRSSHKYIEAVMQSASRGKVQPIKQGYLL
KRSSNLRGDWKRRFFVLDSRGMLYYYRKQWGKPTVRTSNDDKTIAHHTVNLLTSTIKMDA
EQSDLRFCFRIISPSKSYTLQAENGMDRMDWMDKITGVIASLLNSQVTEQPRSPLNNFHQ
RSPSESSSVSASSDFEHSIGDDIKFSRRDRMYHNLELQERPLDILRRVSGNEFCADCGAA
DPDWASLNLGILICIECSGVHRNLGVHLSKVRSLTLDVRVWEPSVIGLFQSIGNAFANSM
WEEQLPKWEGERSRNNKNALTAGSATERYNHLLFPRTSFSIVCLCRGNVGTDMKVKPDAR
DPLAVKEKFIFAKYVEKRFVVKMKLDPRGPSVARRIWDAVQANNKQSIVRLLINGDADAN
TTSLDSLRLSEASSISGKAGALTLSSDTGVENLRGQTLLQQACQVGDLSTVELLLQHGAQ
VNTKDGIGRTPLHFCVECGRNLCAKLLLSR
Download sequence
Identical sequences jgi|Selmo1|232336|fgenesh1_pm.C_scaffold_24000083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]