SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|236037|fgenesh1_pm.C_scaffold_109000006 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|236037|fgenesh1_pm.C_scaffold_109000006
Domain Number 1 Region: 269-642
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.96e-118
Family Oxysterol-binding protein 0.0003
Further Details:      
 
Domain Number 2 Region: 10-50,86-143
Classification Level Classification E-value
Superfamily PH domain-like 5.14e-17
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|236037|fgenesh1_pm.C_scaffold_109000006
Sequence length 650
Sequence
MIEGRSSAANPNVAGVLHKWVNFGKRWRSRWFVLHDGVLSYYKVHGPDKLYVNQELQKGV
RVIGDEAQKLMRKPRKHWNEKRPRKTSGDVHLMVASIRKSKSDDKKFYIFTGTNSLHLRA
ESRDDRATWLEALQAGKDLLPKIICLQPHEEDSISTDGLRKRLIEAGVSQGVIKDCENII
LTEFREKAEKVELETTVVEESRSHEDQPQERDHGMEKQHAVNRIRRKTTAKCSMRKLMTT
TTYISTQPNLSQAHFGVHRFFTLPDPKEKEKGFSLWSIIKDNIGKDLTKVCLPVYFNEPI
SSLQKCFEDLEYSYLLDRAAVCGQMGNSLLRILYVAAFAVSGYASTDGRICKPFNPLLGE
TYEADYPDKGVKFFSEKVSHHPMVVACHCEGRGWKLWGDSNLKSKFWGRSIQLDPVGILT
LEFDDGEVFQWSKVTTSIYNLILGKLYCDHYGTMRIQGNRDMSCKLKFKELSIIDRNPHQ
IHGFVYNKANKKLATLFGKWDGSMYYVNGDLATKPRGYDPMCEAELLWARNLPSDYPTRY
NLSSFAITVNELTPGLEEKLPPTDSRLRPDQRHLENGEYEQANSEKLRLEGKQRRARKLQ
ERGWQPRWFHKDIGSSTFKYIGGYWEARSQGDWSNCPDIFGQSLPDDGSD
Download sequence
Identical sequences D8T4G5
jgi|Selmo1|236037|fgenesh1_pm.C_scaffold_109000006 XP_002990539.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]