SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|267397|estExt_fgenesh1_pm.C_140030 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Selmo1|267397|estExt_fgenesh1_pm.C_140030
Domain Number - Region: 280-388
Classification Level Classification E-value
Superfamily PH domain-like 0.0307
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|267397|estExt_fgenesh1_pm.C_140030
Sequence length 410
Sequence
MKSSPERIQGSGFHHSFASKSSDFKGSFLHLENIQEDSAVSFPSPTPGFPEPETPQEPLE
FLSRSWSISAFEVSKARAASQTSIATPPPPLPSAQDDCSTTISSSQESNLEGAPFVFAPS
MTSQMVMDRIMLRGRSSVGRWFKDMKERKKELSRAHNAQVHAAVSMAGVAAAVAATTSLA
VASAASLVAAQCVDLAESLGADHDHITHVVSSAVNVKTAGDIMTLTAAAATALRGAATLK
ARTLKDAKSHATVTPYDKHALHFNSGDLGSEDGEAESYTQEVLNRGCEFLKRSKKGELHW
RTVSVYSDPNNGQVIVKIQSKHMGLRKKRKGIVLDVDANIPAWPGRSLLDNGEQRRYFGL
KTATGMLEFECKSEYEHRLWTQGIAHLLHLSSQHSVALTTTSTQSSTKRP
Download sequence
Identical sequences D8RGF1
XP_002970216.1.77236 jgi|Selmo1|267397|estExt_fgenesh1_pm.C_140030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]