SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|267774|estExt_fgenesh1_pm.C_250008 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|267774|estExt_fgenesh1_pm.C_250008
Domain Number 1 Region: 170-375,404-433
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.17e-31
Family Phospholipase D 0.053
Further Details:      
 
Domain Number 2 Region: 486-602,650-735
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 8.72e-30
Family Nuclease 0.088
Further Details:      
 
Domain Number 3 Region: 6-153
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-18
Family Synaptotagmin-like (S variant) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|267774|estExt_fgenesh1_pm.C_250008
Sequence length 804
Sequence
MAQILLHGTLHITVYEAASLVNENRVSGASPKFMRKMVEGVEDSIGIGKGVSSLYATIDL
ERQRVGRTRLIRKEPTKPVWNESFHIQCAHNIANVVVSVKDDLAVSAFLLGRAKVPVKRI
MYGELVEGWFELYNDSGKKLGNSRVRLRLQFFDITRDPRWGRGLVDGTKFPGVPFTYFPQ
RKGCKVTLYQDAHMTDNFLPKIYLQGNAVREPTRCWEDMYEAIANAQHFIYITGWSVYAE
IALIRDSARPVHGGLNVKLGDLLKKKADQGVRVLMLVWDDRTSMSVVKMEGLMATHDQET
LNFFYGSKVKCLLCPRTPDSGLSYVKGFQIGTMFTHHQKTIIVDAPGRSHQQRRVVSFVG
GLDLCDGRYDTQFHSLFRTLGTVHKEDFHQPNYAGATIDKGGPREPWHDIHSKLEGPVAW
DVLRNFEQRWHKQGDGNQHLVSLGNLEPQSSLVEDEHDENTWNVQLFRSIDGGAAADFPE
SPEAAAAAGLVSGKDSTIDRSIQDAYIHAIRRAKDYIYIENQYFLGSSFAWESDHDAEAH
HVIPRELALKIVSKIEAGERFSVYVVLPMWPEGVPESGQVLAILDWQKKTMQMMYKAIAQ
ALDAQGIRGVSPRDYLAFYCLGNRERRLGGEFLPPSTPDANSAGYRSAQENRRFMIYVHS
KMMIVDDEYIIVGSANINQRSMDGGRDTEIAMGAYQPLRTWPTRGQIHGFRMSLWYEHMG
QLDDLFLRPSSLECMRKVNRTADQLWHMYAADEVVDLPGHLLAYPVGIASDGSVAELPGC
AKFLDTDAKILGVKSDVLPPILTT
Download sequence
Identical sequences D8RUM2
XP_002974536.1.77236 jgi|Selmo1|267774|estExt_fgenesh1_pm.C_250008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]