SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|269402|estExt_fgenesh1_pm.C_880027 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|269402|estExt_fgenesh1_pm.C_880027
Domain Number 1 Region: 183-390,419-455
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.13e-28
Family Phospholipase D 0.036
Further Details:      
 
Domain Number 2 Region: 524-626,669-751
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.54e-26
Family Nuclease 0.074
Further Details:      
 
Domain Number 3 Region: 16-169
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.05e-22
Family Synaptotagmin-like (S variant) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|269402|estExt_fgenesh1_pm.C_880027
Sequence length 830
Sequence
MEDVSLGASSPKVCLLYGTVELEIIEAKSLPNMDWFSERASQCFSILGGLQTMCAKPKDK
LAHHRHKITSDPYVVFSLGDAILAKTKVISNSQIPHWGERFQLHVAHSVPEVLLTVKDND
VFGAQVIGGVKIPAHRIASGPAIVETWFDVVGSGKEGAQLKISIKYTPVEQDKNYQHGVG
AEGAVPRTYFPLRKGCSVKLYQDAHCPDGGLPEITLEGGGAYEHGKCWEDICQAILEAHH
LVYIAGWSVFHKVKIVREPENHKKFSNDIANLTLGELLKRKAAEGVRVLLLVWDDKTSHH
TPLFTTKGVMATYDEETKKFFRHSAVRCVLSPRYGDSKMSWLKQWVVGTFYTHHQKLVIV
DSQGRGNNRKLTSFIGGLDLAQGRYDTPEHPLFKTLGSIHRDDYHNPTFTGTIDHGGPRQ
PWHDLHCRIDGPAAYDVLTNFAQRWRKAATWHEDAMIEIDRISWILSPNDGDQALMVTEL
DDPETWNVQVFRSIDSGSVKGFPKEPADCQKQNLVTLKNVAIDTSIHTAYVERIRSAQHF
IYIENQYFLGSSYAWPDYKKGDATHMIPMELALKVASKIRSGDPFAVYVVIPMWPEGVPD
SATVQEILYFQSQTMKMMYKIIAQALNEVGSGNHPTDYLNFYCLANREERSEPGTMAPAE
KSTQWYAQKYKRFMIYIHSKGMIVDDEYVIIGSANINQRSMDGSRDTELAMGAYQPHYTW
AHKKHSHPFGQVYGYRASLWAEHLGDFDPALFNDPSDIRCVHKVNEIAQGNWKQFVSEEP
SDMKGHLMSYPMSVQVNGEIKPIAGNESFPDVAGQVLGQHSINLPDNLTG
Download sequence
Identical sequences D8SYL9
jgi|Selmo1|269402|estExt_fgenesh1_pm.C_880027 XP_002988389.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]