SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|28398|gw1.79.170.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|28398|gw1.79.170.1
Domain Number 1 Region: 8-124
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-41
Family Dcp1 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|28398|gw1.79.170.1
Sequence length 126
Sequence
DQQSTKELNLTVLQRMDKHVEDILTTAGHVTFYEFSMDLNQWSRKDVEGSLFVVKRQGWI
LRMQPRFQFIVMNRRSTENLVEDLLSNFEYEVQVPYLLYRNAAQEVNGIWFYNPRECEEV
AKLFSR
Download sequence
Identical sequences D8SV82
XP_002987171.1.77236 jgi|Selmo1|28398|gw1.79.170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]