SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|35924|gw1.8.776.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|35924|gw1.8.776.1
Domain Number 1 Region: 5-239
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.06e-84
Family Inorganic pyrophosphatase 0.000000481
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|35924|gw1.8.776.1
Sequence length 242
Sequence
QSSDYQVREQGEAQSMGYRAFLVGANGKTLSPWHDVPLKSPLGGGEIFHFVVEIPKESSA
KMEVATDEPFTPIKQDIKKGKLRFYPYNIRWNYGLLPQTWEDPNHANPEVEGALGDNDPV
DVVEIGERRAGLGEILRVKPVAVLAMIDEGELDWKVIAISVDDPKAALVNDESDVEYYFP
GTLTEIRDWFRDYKVPDGKPQNRFGLGNKAAGKDYALKVIQETHQAWVKLVTRSVPAGDL
SL
Download sequence
Identical sequences D8R7G2
XP_002966920.1.77236 jgi|Selmo1|35924|gw1.8.776.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]