SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|407570|fgenesh2_pg.C_scaffold_7000201 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|407570|fgenesh2_pg.C_scaffold_7000201
Domain Number 1 Region: 65-180
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.42e-22
Family ABC transporter ATPase domain-like 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|407570|fgenesh2_pg.C_scaffold_7000201
Sequence length 185
Sequence
MPWRKRSVNDLDLSANKSLKLDKTTGTYSGSRRRSLKIFNGVANLLAELDVLLSFVDLAV
GSPVRPIITGQNEDDIILEGSRHPCLEAQDEVNFIPNDCRLIRGKSWFQIIIGPNMGGKS
TYMRQIGVNILMAQVGCLLPCDRAEFSTRSCIFARVGAGDCQLRGVSTFMAEMLETSVIL
KSNNY
Download sequence
Identical sequences D8R612
jgi|Selmo1|407570|fgenesh2_pg.C_scaffold_7000201 XP_002966557.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]