SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|409859|fgenesh2_pg.C_scaffold_11000242 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|409859|fgenesh2_pg.C_scaffold_11000242
Domain Number 1 Region: 912-1199
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.44e-88
Family Motor proteins 0.00000000348
Further Details:      
 
Domain Number 2 Region: 406-523
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-20
Family Second domain of FERM 0.0011
Further Details:      
 
Domain Number 3 Region: 528-616
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000117
Family Phosphotyrosine-binding domain (PTB) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|409859|fgenesh2_pg.C_scaffold_11000242
Sequence length 1224
Sequence
MEATDVKTRRPSSFSANTPVHPRSSMTGLSSSNSTPVHPRATGAANGHDYDSDGSDLPAS
SEVLDDAGVDDASVEGDTRTPRTISSTLVPDLVGAIPILDKFQVDAFIKLMRKQLQSGGK
RGFFTKKSVVPQGRESYSVEDMLCFQKEPIPTSLLRINADLVSRAVKLFQAILKYMGIDA
QTPSPLNSQDQLAIVLKIYKHTLKRVELRDEVFAQISKQTRNNPDRPLLLKAWELLYLCA
SAMPPGKDFAAYLSEYVHDVASSQNSDAEIQALALKTWNALKRTAKAGPRRTIPAQEEVE
ALLGGRKLKTIAFFLDETFEGITYDMSTTVMDAVEELAGIIKLSAYSSFSLFECRRVLVG
TKAVDSGNDEHLGLDENKYIGDIVAEFKAIKERNKGELLQCKLLFKKRLFRESDEAITDP
MFVQLSYVQSQHDYLLGNYPVGRDDAAQLAALEVIADIGPANEAEPIMDWSALVDRYLPK
QVAITRARHDWDSDIFARYKAMGHLSKDDARQQLLRILRSLPYGQSIFFNVRKIEDPIGL
LPGRIILGINKRGVHFFRPVPKEYLHSAELRDIMQFGSSNTAVFFKMRVAGVLHIFQFET
KQGEEICVALQTHINDVMLRRYSRTRSVANGAIQSNGESAVPNFKPPGIELAGELREKDK
RQTSLLEELEGFKDRLRAEQQTVTDITQEREKLRKAVEEKETALQAALAEKSADDEHGRE
EAAPTKKGILRGSIGRRDRDLPFAEKASSALEAQVKDLRNELKSKSEEARLAEERNKKLM
NEKQLLEQKVSRVEKLKGEETKVLEKKFEEERSMLRVRISELEKKLNERTQEISVAEAAL
SLRTSELEAMQCSMKELEELREIKEDIDRKNAQTAELLRRQADQLAELESHYKEEQILRK
RYFNMMEDMKGKIRVYCRSRPLVEKELNENQKAVIISADEFTVEHIWKDDKTKQFQFDHV
FDEHASQDAIFEDTKVYMLELYQDNLFDLLLLRNAKRQKLEIKKDSKGMVVVENVTLIPV
STREELDNLIQKGLEKRHTSGTQMNAESSRSHLVLSIIIESTNMQTQNVVKGKLSFVDLA
GSERIKKSGSTGEQLKEAQSINKSLSALGDVISALATEEQHIPYRNHKLTMLMSDSLGGN
AKTLMFVNVSPAESNLEETHNSLCYATRVRSIINDPTKNTNTKEIVRLKKMLGYWKEQAG
KKADEDELEEIKDERTGKEKMESS
Download sequence
Identical sequences jgi|Selmo1|409859|fgenesh2_pg.C_scaffold_11000242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]