SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|411388|fgenesh2_pg.C_scaffold_14000441 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|411388|fgenesh2_pg.C_scaffold_14000441
Domain Number 1 Region: 197-231
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000549
Family Rho termination factor, N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|411388|fgenesh2_pg.C_scaffold_14000441
Sequence length 260
Sequence
MTEPVRGMFCNTEVYRAILSAATSDDISWLLLHFKRPLVKGARYLLDFASSKIKYLFTET
LVRTKQEDLRTLVQSTDPELGALRGYVIEQEVVRLVLDSNLAAVTLTMPKNQECARCPLP
VPSLWNFESFEGETIHEGISTGGLRLRYYNGDLKTALPAAGIIQVKILIETYELLQLAHP
VAGSVDKLIDLEYDEQYDLHKMTVRELKDLAKSWGLKGYSSLKKDALVEALNAWEEPQVL
ESREYESKSYQEMYGDRVVV
Download sequence
Identical sequences D8RHH1
XP_002970396.1.77236 jgi|Selmo1|411388|fgenesh2_pg.C_scaffold_14000441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]