SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|411671|fgenesh2_pg.C_scaffold_15000273 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|411671|fgenesh2_pg.C_scaffold_15000273
Domain Number 1 Region: 77-174
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000114
Family B3 DNA binding domain 0.021
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|411671|fgenesh2_pg.C_scaffold_15000273
Domain Number - Region: 204-324
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00745
Family Galactose oxidase, central domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|411671|fgenesh2_pg.C_scaffold_15000273
Sequence length 345
Sequence
MAKNQEASRARGKRSRGSGAGDGAQNEEEQPRNRRFRAAPGPGAGAAPVDDALRAGAAPG
DGALRAGAVPGAGGQRFSKRLTATDVSQQNRLTIPKNYTCFFTEEEDDEAIDQGEAVAKD
VKLHHGNFEWTLGMRFQAGRSNYLLNWKPVVDHLHLEAGRMVTLSKLGVYDFLLEACVQS
MGFSHLPQLLPVLWRSAGGHGVLYKQYGVTRNYTLWIYGHESDNVMVYKSETGEWSEMKK
RYLGKVDYATTVSGPGDIRTLYIWKCEPRRLVAKFPFRDEWVRRFNRRPPLHFSDLVGNM
VICSFMFHGVYMAYDLVHDTWDTFQTVELKSAQYYEPFIPSLDKP
Download sequence
Identical sequences D8RIN6
XP_002970793.1.77236 jgi|Selmo1|411671|fgenesh2_pg.C_scaffold_15000273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]