SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|413639|fgenesh2_pg.C_scaffold_21000128 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Selmo1|413639|fgenesh2_pg.C_scaffold_21000128
Domain Number - Region: 277-349,381-396
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00518
Family BAR domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|413639|fgenesh2_pg.C_scaffold_21000128
Sequence length 496
Sequence
MEPWRFLKPQMWDDLFTPQAAWIEETGLVDFIKLKLKAMDVELVRKATQGYDSESKTIHV
PELGSMELSDKSVGEALCLPYGSDLEEIPTEYNSQLHGPEIQKYFSEKGHSQASGWKLCE
VKEHVMRVYLEFLVKRIGLRLNNQRVSGATAYPACATRSTKKIFNWAQFVVLKMHKELKE
GKPVTTAHYLSMVLQHHFDLPGVDLQPTMRFATTGEQSGKRKRLSWEDRSNERDGTPDED
LIVETLRQGDELREVAIRPCSSSSSLPSSKFVFGESSGGSRGGALTFCSMQQKQVLSAVD
GILKQMKQTVIQQKEALISSLWQAQQAVAQLETPERSLDFDQLSARYAQLQQDYRSVCHQ
RDVLLQQVTDLQDQFRASDELHSQRLEEANERLAKATRKLTEAKQANRAKHSHSTADLHE
SDCIMEYGFSRSELENVEHMIIGHRSSSQAKHARFSISCEDSHHGRGNASAEADWLCKLL
KPSDKKLSRSESQAFR
Download sequence
Identical sequences D8RPR2
XP_002973350.1.77236 jgi|Selmo1|413639|fgenesh2_pg.C_scaffold_21000128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]