SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|413974|fgenesh2_pg.C_scaffold_22000101 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Selmo1|413974|fgenesh2_pg.C_scaffold_22000101
Domain Number - Region: 17-133
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00628
Family FCH domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|413974|fgenesh2_pg.C_scaffold_22000101
Sequence length 264
Sequence
MPIQKSPESFSGFSSCIVRSMLEELNQLRRDSKTRTLNAPLQKKYDDLENSLNKCKDDLR
DLQRKAVTASPSQLRSKYEALGDELKKYKQDLEALHSETQSADSESLQKKYEALQFVLLR
YRKDIEDELQKCWTQLKLLHLESQLASPTHVTSFDDGGEGEGEGEGDGESEAGGDETSAC
KGSETESEADKLRLVPLALERNPRRPRCALLWKPPLPDSRDKTKHYDERKLLEHLTCRKH
RLGYRSKPPKYFPQCEVENCGDSF
Download sequence
Identical sequences D8RR81
XP_002973535.1.77236 jgi|Selmo1|413974|fgenesh2_pg.C_scaffold_22000101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]