SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|414325|fgenesh2_pg.C_scaffold_23000189 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|414325|fgenesh2_pg.C_scaffold_23000189
Domain Number 1 Region: 146-181
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000168
Family Protein kinases, catalytic subunit 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|414325|fgenesh2_pg.C_scaffold_23000189
Sequence length 236
Sequence
MVRCERCPVFLLEVSGPLLKIAGAAVCFQSSDRAAQDGPDAATLPYPLQELHCAGVGVEV
LSFGKLYLQSSKAGKEDQSPRTQASSGLVGSNVHAEWSSHGCAPEILSGRWLMELMELME
FKIYRTLLRSITRPPACLSPRSQVLAASGHFPGAVHGDLRLENLLVDRGLTHVVAVDFER
GIEGVDRYMSVVASVELIHLVVFLAQISFVHEPGRRAVAAASRHFRQSLLYFKLQP
Download sequence
Identical sequences D8RSD6
jgi|Selmo1|414325|fgenesh2_pg.C_scaffold_23000189 XP_002973892.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]