SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|415350|fgenesh2_pg.C_scaffold_26000280 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|415350|fgenesh2_pg.C_scaffold_26000280
Domain Number 1 Region: 627-724
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000051
Family Second domain of FERM 0.0069
Further Details:      
 
Domain Number 2 Region: 733-821
Classification Level Classification E-value
Superfamily PH domain-like 0.00000108
Family Third domain of FERM 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|415350|fgenesh2_pg.C_scaffold_26000280
Sequence length 825
Sequence
MDPAGSPDISASPSNAAAAVPPESNAASSSSPAAALVAAEAEQAPPPPNPAPGIVIQEPV
LAGTHDHEASTSGGGGDDQCASPWLASPASTSALQSPPHSPVERALNELAFSRFRNNMRV
EARRSSARRSLLGRLGALPGDETTFSQPKDQHPWQLQNPIPPFPGQDGMAYPPSSAVSSE
GSVGERPSVIAPPGGQPISAYQRFARAEFAEHIYGVGRLVWKRISVDELIRHSRVTLRAP
LLSSLAASPESIKAATVFAHLRNYMEDPAVPENVQPSEIKFLDTLRLMKASIAQKLEPVR
QKLEPAKAKVSELLNKIDKVLRTKFFIQRTRLYHLQQILLIGIKYKAVRDEIYCQICKQT
TLNPARVSDARGWQAMAVCAGTFPPSEKFRPVLEEHLKQIVDGIVGGMPDQEKARSMALY
CLNRLRKICRVGARQVAPSSEEILASEVTKHMHVTSINVAIPGGLAQVVSMDSMTTGGEV
TAEIAARLGLPDVGFYGIFIVTNGVERFAGTHGLLSESYTEWNVGPSPELEEEVQAFRRT
RHFLVDHCAQCLYNMDPDSVLGKDLKHGISAMEHLKEKEMQEKAGREAKETDPEEEEIRD
AELRRLFADVHLLFKRNRFPVEGTASSDSVRAFEYAQATYDVVHGLYVIEEADAVMLAAL
QLRAEHGSSTDLDKYLTVQTVENYGPKEYVTGYEKAWRSAILKKVATLPWEVDVNVCRND
YLAFLRSRCPLYGSSWFYVVPKACPQFPRELYFVLNLSGVHFVDIPLKEKLLHLRYIELC
SWGYSDSSFSLVTGNMSYNMEFRLGTRNGKEIAKILQYFVQHTEL
Download sequence
Identical sequences D8RVU6
XP_002975050.1.77236 jgi|Selmo1|415350|fgenesh2_pg.C_scaffold_26000280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]