SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|415477|fgenesh2_pg.C_scaffold_27000091 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|415477|fgenesh2_pg.C_scaffold_27000091
Domain Number 1 Region: 184-342
Classification Level Classification E-value
Superfamily Bet v1-like 1.47e-19
Family STAR domain 0.017
Further Details:      
 
Domain Number 2 Region: 7-113
Classification Level Classification E-value
Superfamily PH domain-like 0.00000043
Family Pleckstrin-homology domain (PH domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|415477|fgenesh2_pg.C_scaffold_27000091
Sequence length 714
Sequence
MAQAQAYAGWVYHVGINSKDLQYCHARYLVIKGRCVDMYKRDPQEEPGLQPMKKGIVRHN
LMVAEIGRQIVYGRVLYGMKIHSKRDHSKHVQFACSSAEEIEKWMSAFRHAKDEAELEAR
KTSARAPSLTEEESKQTLPRMRSKSRLSRLITIGKGPEMLMRARTSMIQEADTDDYFNKR
DGDAVEQADWRCFQTQNGLRMFEDVAALQADRGTIMKSVGVVDASPDAVFEIVMSLDKSQ
RHQWDVLTGDLELVEHIDGHADIVYGTFDPKYFENWSWYRKYKRRDFLISRYWRRDQDGS
YLFNVRSHAAGIWEINPLPTRSGATGSRSLVTQVMEIESTGWGRWRKSWGKWKKSDYSSF
RKTVPYILLCRTAGLREFFKAEAELSLLEDRISVLNVPKEAAKPLETAADTEVTEDFIDA
IVSEDPDAGDDTEGLISNIPFQRGSHRLSRAPWSAMLALAAAQLENPLLADEPRINLDVN
AFKGSLEPASPSKDCNCWEDPGGKGFMVRGRTYTRDNLKIPGGEPVLKLLAVDWYKSAHR
IDLVARHPQSIVRTEAGKKLPFVLIVNLQVPAKPNYSLVFYYAADRSLRPSSLLEKFANG
DDSFRNSRFKLIPSIVEGYWVVRRAVGTKACLLGRAVACHYHRKDNYLEVDVDIGSSSVA
RGVIGLVLGYVTKIVVDLAIVVEAKEDDELPEYILGTTRVNRISPESAVPFQLG
Download sequence
Identical sequences D8RW84
jgi|Selmo1|415477|fgenesh2_pg.C_scaffold_27000091 XP_002975423.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]