SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|415650|fgenesh2_pg.C_scaffold_28000069 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|415650|fgenesh2_pg.C_scaffold_28000069
Domain Number 1 Region: 624-872
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.41e-35
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0049
Further Details:      
 
Domain Number 2 Region: 226-429
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.05e-27
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0066
Further Details:      
 
Domain Number 3 Region: 28-107
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000000000000421
Family FHA domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|415650|fgenesh2_pg.C_scaffold_28000069
Sequence length 920
Sequence
MGDSRGRFVVRPLAAQSFLADLEVAPGKIYTVGRSSCCDLVFKDGRVSRRHCQIFVDAGN
SLVLHHGVEKGADICLRSSVVYVNSERISLGSSRVLVPGDRVFLVAPVKDSIQDTGFTVE
NAGESSDAIRSSLEELEMNVQRRQVKSKADHLGPSLNCKVKRVKASVEKLIDKSRQLRSE
CFTRNSSLENRAFVGKERDLEEVEQIGGDTKVASCDSFPKSSGLCMNKLEDVQPSRTDVS
VADLLAPLEDIREMFVASFTTDIIWFISSFGLPKTLPVTIACHDSERSWSTAISDRMEHP
YCEWPNLKVVYPPFPVLRRTNDKSRMRGVGCHHPKFFLLKRSKDIRVIVTSSNLNYRQWL
QVSNTVWWQDFPLRNTRDYSSLFSSKITDGGERNGDFAAYLAGFISTLVKDVPSEAHWAT
DLACYNFSKATVSLVASVPGLWEELLPFPESMKELEKSYLGTVATTVAGISHQFSPKCDP
NGLRLRKLAALLNSLPLDPEGMVHVQLKRAKDLPADPNAVVISVVPPTQQLRFLEQSDIV
SQAEELPIGFLPKRAAAWVSTLCDAGLCSLRAMLWPKQVLGVAAGQSKSVLQLKLHVFEG
SKFGELLSKDQESAMSNLLRHIQRKYGLRRLKEVLAEHKWPDSAEVDFVYCSSSIGTSLS
SNFLASFSDAAGRKASLDDSCESDPEWGRWTAEHEAANPSIKVVFPTLDRLKSAKWGPSS
YRGILCFAERTWERIKSTSAVNLHDAIPCPPSREGIPMHVKVAQRRFKSPTSSQAFGWIY
TGSHNFSPAAWGKYINKAARNDDEYQPPCTRLHICNYELGIIFIDPPPTYQDDGDSNTTK
QQNHGGIHSFTLPFRVPAPKYSSLDRPATGSAIFQLVQQLGEGQRSVLNEAGEHEGVSLS
DVEIDTQEPEEDDASSSACL
Download sequence
Identical sequences D8RWT4
XP_002975681.1.77236 jgi|Selmo1|415650|fgenesh2_pg.C_scaffold_28000069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]