SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|415777|fgenesh2_pg.C_scaffold_28000196 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Selmo1|415777|fgenesh2_pg.C_scaffold_28000196
Domain Number - Region: 90-164
Classification Level Classification E-value
Superfamily TPR-like 0.00448
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|415777|fgenesh2_pg.C_scaffold_28000196
Sequence length 166
Sequence
MPAAQHIFDSSPSPSARACWNALLAGYSIHGHCDRVLDLFAQMRREATDPDAITLLAILA
ACSRGGMPDLARRILAAMPERHGISPSARHYACVADALARAGRGGEAVEVVAGMPVAADG
ACWMAVLGSCRRWRNVAAAEKAFQELLKIDESKPAAYLLMANTYCY
Download sequence
Identical sequences D8RX76
XP_002975581.1.77236 jgi|Selmo1|415777|fgenesh2_pg.C_scaffold_28000196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]