SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|416323|fgenesh2_pg.C_scaffold_30000084 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|416323|fgenesh2_pg.C_scaffold_30000084
Domain Number 1 Region: 350-621
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000301
Family MIF4G domain-like 0.092
Further Details:      
 
Domain Number 2 Region: 36-99
Classification Level Classification E-value
Superfamily PH domain-like 0.00000082
Family Ran-binding domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|416323|fgenesh2_pg.C_scaffold_30000084
Sequence length 862
Sequence
MDGAVSSARALGSKVMSSSQSNNEAATQLDLNYLQVYRLNDEGRWDDKGTGHVSVEYLER
SDALGMVVIDEEDNNTLLVHRISADDIYRRQEGRNDYFMDGSRDCHRSGSELPRGHGVWV
YLLWKTGPVLQVTNWNILVHLKTMVSFWNIVLYRTILIHCATDDVLHDSGSSEIQQLPGV
ELSSLPQIVKTIAEVAPPDKDRVASLIMKEQSYIPKLMELFRLCEDLENVENLHMIFRIV
KGMISLNDKNVFDTIFSDEHVMDVVGALEYDPELSSQQDHRGFLKTQVVFKEAVPIHDVA
IVSKIHQTYRIGYVKDVILPRVLDDQTFANMNSMMLANNKAVVSALHSDKTFVSDLFAKL
RSPDISQNVRNDLIYFLHEFCNLSKNLLSLHRSELFGSLVEKGIFEVVTMALQSEDLNLR
VSGSDILIVILNHDAALLRTFLVQQEGHVLFGLLVKGLLNSSEGGLQAQILEIMRMLLDS
EPSEQQPTEKIAYLEMFYEKYIDQLVEVLTSSCPTKVVTEHSKRVPTVEKTQASGEVLGN
ICELMCFCVLHHGYRMKYYVMRNNVVEKVLRLVRRKEKVLVVAAVRFLRTCVGLKDNFYA
RYLIKNNLFEPVIQAFLANGNRYNLLNSAVLELLDFIRKSNLKDLLIHIVENYGKKLECV
DYVDTVKQLKVKYDQQHWFLTSDLLSDDEEDSAQTSQTITVNGNAVEDAPFRPFCLVDYD
DEDDDSLVPSNGKSRPRKSDGSEHWPHAKRRPHLGDFSIHKKLRQDSGGQSELGKQEVDG
INRISVEGKPQIGRTTDQQPGNLKGGLDDKRDSTKSSSSKVRDDSVVSRLGAPGRVSAGC
KLQIEAKPRIPAASSPEQSSSR
Download sequence
Identical sequences D8RYX5
jgi|Selmo1|416323|fgenesh2_pg.C_scaffold_30000084 XP_002976251.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]