SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|416931|fgenesh2_pg.C_scaffold_32000169 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|416931|fgenesh2_pg.C_scaffold_32000169
Domain Number 1 Region: 94-295
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.34e-39
Family Tyrosyl-DNA phosphodiesterase TDP1 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|416931|fgenesh2_pg.C_scaffold_32000169
Sequence length 301
Sequence
MPDRVELNLHQIWLQCEDYPELAVQISTGDIVKMLPGDRFFKFMLCSSLKGKAVASHSDN
VLASNKRKRQIEDDEAFARALQQQLLRVQGLLDWANAGCVRICDVIKVIRALVFLRIRIL
LFAILSNYMVDIEWLLSACPLLRTILQVVMIHGESNVSQLQSVKPSNRLLFKPRLWIAYG
TPHSLLVYPTGVQVVVHTANLINIDWNNKNQGLWMQDFPFKSKTGASDFENDLVDYLTAL
EWLGCTVDVQHHGKMKINVGHFRNFYFSNAAVRLVASVPGYHSGPQLNKWGHMKLHFTGF
R
Download sequence
Identical sequences D8S0U8
jgi|Selmo1|416931|fgenesh2_pg.C_scaffold_32000169 XP_002977000.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]