SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|420673|fgenesh2_pg.C_scaffold_47000147 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|420673|fgenesh2_pg.C_scaffold_47000147
Domain Number 1 Region: 90-191
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.19e-16
Family alpha-D-mannose-specific plant lectins 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|420673|fgenesh2_pg.C_scaffold_47000147
Sequence length 194
Sequence
MKRKRIAYVWKNFGIDYVSWARRPGLDTSNRVRVPGSIKLAWPQRPALDTASNPVRLLGD
PDPDWGNCWPFRSSIIGGADEAVGSIIGRSATLVSPSGRYKARMQRDCNFVLYDTYRDTN
KVVWASDTFGKGTECSLILQIDANLVLLDAKGTILFVSGAFCDSCALTAALSVTDGGYIV
IWETDYQTELWRKP
Download sequence
Identical sequences D8SCR5
jgi|Selmo1|420673|fgenesh2_pg.C_scaffold_47000147 XP_002981057.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]