SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|422967|fgenesh2_pg.C_scaffold_59000096 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|422967|fgenesh2_pg.C_scaffold_59000096
Domain Number 1 Region: 205-257
Classification Level Classification E-value
Superfamily BSD domain-like 0.0000115
Family BSD domain 0.014
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|422967|fgenesh2_pg.C_scaffold_59000096
Domain Number - Region: 21-103
Classification Level Classification E-value
Superfamily PH domain-like 0.00455
Family TFIIH domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|422967|fgenesh2_pg.C_scaffold_59000096
Sequence length 569
Sequence
MAGASASWRAKSLPNPKSDGIPGILTMTPSGFKWTPNIPNAAKALNVDCRSLRGQRASKE
ATSKKAILNLLTDSTAVQYFFEFENFVDRDASRNFLAPFLANAATPIANNELAANQASTS
ARPPGQNESLNQTEMERRIKLLQGDRQALFLRCFCFKAALRVCQLINNSASICGVQKTGD
NHKMRTGMASTMLADIRPMADGRTNTVTFNITPEIIHQIFAEKPAVHRAFLNFVPSKMTE
IAFWTKYCRNDYLHRTKNAAAATAEAQDDEELAVFVNDDDIIAKEYRRKIKRVDPTLDIA
ADNADSSLPGHGIYRDRAKDPIDGNMRNKLMRDINRHGEVVLEGRLLEENRNDAMSIAQA
LAKVQQQGCVWFELDPRKYFDVQANTNIGASSSSTLHPNEILQRLRQQIEEFEHQDETAP
IIPGSLAFKVLTELTQQVSSTHHSLGRTAEKNVLDSLPRSVREALLQHSSFINEVLRQFW
ATCPITSNALLQKANRLKDCMAKVYNEIQALKSSVQSEHRHQVSLILQPMFQTLDAALVH
YEAEIEKRSAKKLGNGGPSEHVNGMLAVK
Download sequence
Identical sequences D8SK47
jgi|Selmo1|422967|fgenesh2_pg.C_scaffold_59000096 XP_002983776.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]