SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|425805|fgenesh2_pg.C_scaffold_77000069 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|425805|fgenesh2_pg.C_scaffold_77000069
Domain Number 1 Region: 312-321,432-457
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000863
Family Formin homology 2 domain (FH2 domain) 0.057
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|425805|fgenesh2_pg.C_scaffold_77000069
Domain Number - Region: 383-520
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0837
Family BAR domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|425805|fgenesh2_pg.C_scaffold_77000069
Sequence length 558
Sequence
MSASAAGADQGSSANGIMKSFSKNSIRRGFFPEGAFNVRVASDPAAMARHQQHLDDSDDA
TPVLEVALPSDQHHHSPPSASKKPTSSTTSSSSSSSSSRALFTFPSKWDDAEKWLKSSAK
KSGKRQQIHGFKKLHQQPQGGGDRELESSDLIQGDRVEELEEDEDEEGESEDREKKMMID
SSSTSSSMAAGVVGSRFSFPMVKSDGGKALEATICEAVKNQQLRIQKPFTDPTEATSGFD
FKQDPHQPPKSPTSLYESVACIAPGPRSISMRDMGTEMTPIASQEPSRTATPMRTPIMTS
PGVSPGRLRPIPPPPPPPPPPQATTPTMPPNYRSTGTDASPPPPLPPPGDHLDEQLASIP
ALPATPGGATIHTTRNATRHEILVLGTQLGKSSIAAWATREEEENDASKCLKVVIQQQQQ
QNQTVDSLRPAVDLDEVRRTMVESRATAWEEAEHAKYMARYEREEAKILAWENHQKAKAE
AELRRMEVKVERMRSHAHERMMNKLAAARRRAEELRAAAEAKRGEKAAKTVERASEIRRT
VCRHSELQRFRLAFRSRI
Download sequence
Identical sequences D8SUC8
jgi|Selmo1|425805|fgenesh2_pg.C_scaffold_77000069 XP_002986970.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]