SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|425936|fgenesh2_pg.C_scaffold_79000001 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|425936|fgenesh2_pg.C_scaffold_79000001
Domain Number 1 Region: 112-170
Classification Level Classification E-value
Superfamily TPR-like 0.00000949
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|425936|fgenesh2_pg.C_scaffold_79000001
Sequence length 182
Sequence
MEEKTLVSWNAMIGAYARLGREDLVLFLFRAMDLDGVRHNRITFLNAIAGIQSIDRGKFV
QERAAAAGFEGDIAVRNALPKEEHYGSLIDMLAKAGWLQEAEALIETLPFHPFAVAWTSL
LGASCNHKDVDRAERVAAKAIDREPGNAGPYISLSNMYATLNRWDDVARVKKLIASLKGG
GQ
Download sequence
Identical sequences D8SUT0
jgi|Selmo1|425936|fgenesh2_pg.C_scaffold_79000001 XP_002987174.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]