SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|427280|fgenesh2_pg.C_scaffold_89000102 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|427280|fgenesh2_pg.C_scaffold_89000102
Domain Number 1 Region: 11-124
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-21
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|427280|fgenesh2_pg.C_scaffold_89000102
Sequence length 319
Sequence
MAMMENKSLLWAHPEKSGQLLKRGSDIKSWKKRQFALKDTFLFYFKILPTVEQSEPTGVI
PLQGCKVEAIPAGVHGIKKYSFIINLPDKYILTKAVKRALYILSAHDEPDRQSWIDAIRC
ASVSKQIIRAKLEHSRLEVHDLELRWKVASALDAGKKMPFELQESVVMQALADELMEFIF
PDQMELLNCRHQEALMREGSMQMMHKIRSDESECNGILEYLVAARISLRTLQKQVDALSG
LSEGGEGVPSYVDIEGLLRQTLARLGTLEVSKKKFSRMMVSLFWICSTKHGELRTCQTRS
KLRASMLRSKLATNKRSIW
Download sequence
Identical sequences D8SZ36
XP_002988534.1.77236 jgi|Selmo1|427280|fgenesh2_pg.C_scaffold_89000102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]