SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|428168|fgenesh2_pg.C_scaffold_99000018 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Selmo1|428168|fgenesh2_pg.C_scaffold_99000018
Domain Number - Region: 401-443,513-584
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00942
Family BAR domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|428168|fgenesh2_pg.C_scaffold_99000018
Sequence length 734
Sequence
MGCAASKVSKAEDVSRCRARRRLMKQTVASRHHFAATHAAYIQAMKNVGAAFRQFGETEL
RDAQAAAAERTKSSSLQSPDRPLPPPPPPVFLQDSPRMEFLSPPASPIKTEDHESEEAKD
QERRQRKREQEQQQSRFQKLEQEHEGFYYHRGDDKDDKGAYYFTAPPPPPVPSSTAPPPP
SPPRDSAWEFLDPFRPQEHPVLLHDQRTSKKVENPSVIGSSKRDLAIILLPSGGIGRKDL
LDVVKEVDELFLRAYECGKDVSKLLEARKVHYHSNFVDSRGHESHSKRVLQAISLGHRGS
SKTPLKVVASEDHLSSPEDSGKAGSHAGTLDSLLAWEKKLYEEVKNTEVIRAEYRKKCSP
KLQEEMSDATRSMIKTLSTKIQVSLQGVDTAISAINKLKEDELHTQLVQLIEGLMNMWNE
LYDCHQRQHKIASDMKSLDHWGTVEPTTNIHRLATSQLELALGAWLAGFNKLISAQRDYL
HNLTGWLRLSNMQLELESARETPGSKKKQATARPAWLASMLQLCLDWSLALDRLPDKVAS
ESIKSFEAVVHKLVDLQNEEVKHRKKLDAVSKEFDKKMARLSASTKHRKASREEQQQQAT
DTRKEKDPDKEKAAAENDPPGSAEATNEDSNLVESIPSILRAAANRGSGKSRRRGSPEER
MRQAVNSIQAKLEEEKERVAKVVFDTRATTINSLHTGLPSIFQAVAGFGRISLHAYQSLY
CQAHNGALLRITQA
Download sequence
Identical sequences D8T1Z2
jgi|Selmo1|428168|fgenesh2_pg.C_scaffold_99000018 XP_002989600.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]