SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|430200|fgenesh2_pg.C_scaffold_125000079 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|430200|fgenesh2_pg.C_scaffold_125000079
Domain Number 1 Region: 14-115
Classification Level Classification E-value
Superfamily PH domain-like 2.35e-26
Family Pleckstrin-homology domain (PH domain) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|430200|fgenesh2_pg.C_scaffold_125000079
Sequence length 253
Sequence
MADLARNGAVERDIEQGAQLLKYGRRGKPKFCPFRLSNDETHLIWYSGKEEKSLRLSSIT
RIVPGQRTANFQRYPRLEKEYQSFSLIYGNDRSLDLICKDKDEAEVWFVGLKALVSGGQL
SRLRFDSRSECGPPSDSNSPATWSRISPASSPFGNVDNLPRQDGREAFRFQSPYGSPPRY
ALQQRSFSPGAPSLDSSSKLFLENASTAGSLHSDMSSEPAASVLHLRGGAAAATSAAAAI
PLDANFRVSMSSA
Download sequence
Identical sequences D8T8N6
XP_002991915.1.77236 jgi|Selmo1|430200|fgenesh2_pg.C_scaffold_125000079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]