SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|430894|fgenesh2_pg.C_scaffold_140000015 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|430894|fgenesh2_pg.C_scaffold_140000015
Domain Number 1 Region: 236-626
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.97e-93
Family Regulator of chromosome condensation RCC1 0.00041
Further Details:      
 
Domain Number 2 Region: 14-125
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-23
Family Pleckstrin-homology domain (PH domain) 0.0041
Further Details:      
 
Domain Number 3 Region: 628-694
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.49e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|430894|fgenesh2_pg.C_scaffold_140000015
Sequence length 982
Sequence
MELARCGAASLDRDVEQAIIALKKGSQLLKYGRRGRPKFAPFRLSNDETTLIWFSGRKER
QLRLDAVTKIIPGQRTANFQRYPRPEKEYQSFSLIYGSGGEERSLDLICKDKDEAEVWFV
GLKARVSSNRTLKVDNKSEGTLSDVNSPLGRALRDSPLNSYDSFNRSPYGSPSLFKTAST
GELQSVESAKSDSLASEESLNAQGRSVSLADAFRVSMSSAVSSSSQGSGPEDSDALGDVF
IWGEGAGEGFLGGGVCKLTSGAGSRVDSLVPKALQAAVVLDVSSIACGSRHAALVTKQGD
VFCWGEEYGGRLGHGIDVDVSEPQLVQALAGVNTELVACGDFHTCAVTLSGELYTWGADA
QSGGLVGHSNPVSHWMPKRMSSPLEGVRISSIACGAWHTALVSSAGQLFTFGDGTFGVLG
HGDKRNLAIPKEVESLKGLKTVRAACGIWHTAAVVEVIVGYSSATSCSSGKLFTWGDGDK
YRLGHGDKEQKLVPTCVAALVDYNFRQVACGHSLTVALTTSGRVFTMGSTIYGQLGNPKA
DGKVPGMVDGELARTFVEEIGCGAHHVAALSSKTEIYTWGKGANGRLGHGDVEDRTAPTL
VEALRDKQVKTVACGSSFTAVICLHKPVSDADQSVCSGCKQAFGFTRKRHNCYNCGLAYC
HSCSSKKAFRASLAPNPSKAYRVCEPCLAKLERSASEEVARKSRKYMDGRERPLIRASKP
IEMKQVGYYGNSRNTDDFAAKHQTVINIPTAIPERKAVSAKPSPPRSATPTPTSAGLAPP
GNGPDELQKKLELSRQEVLHLKTQISTLTSKYEQRERELRRGAQKVQEAVLLAGEETAKC
RAAKEVIKSLTVELKELAERMPSARRQQQRQEVPNGRHFPAPEAEIDLRLQTSPTSSNSA
TDTTVDKLVLGSGPEEWVEQDQAGVYITLALAPGGGRDLKRVRFSRRRFSEKEAEQWWQD
NRVRVHQQYSIIRTSNTSKNPT
Download sequence
Identical sequences D8TAV6
jgi|Selmo1|430894|fgenesh2_pg.C_scaffold_140000015 XP_002992739.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]