SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|431226|fgenesh2_pg.C_scaffold_148000022 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|431226|fgenesh2_pg.C_scaffold_148000022
Domain Number 1 Region: 230-360
Classification Level Classification E-value
Superfamily Bet v1-like 5.59e-18
Family STAR domain 0.016
Further Details:      
 
Domain Number 2 Region: 7-113
Classification Level Classification E-value
Superfamily PH domain-like 0.000000459
Family Pleckstrin-homology domain (PH domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|431226|fgenesh2_pg.C_scaffold_148000022
Sequence length 732
Sequence
MAQAQAYAGWVYHVGINSKDLQYCHARYLVIKGRCVDMYKRDPQEEPGLQPMKKGIVRHN
LMVAEIGRQIVYGRVLYGMKIHSKRDHSKHVQFACSSAEEIEKWMSAFRHAKDEAELEAR
KTSARAPSLTEEESKQTLPRMRSKSRLSRLITIGKGPEMLMRARTSMIQEADTDDYFNKR
DGDAVEQADWRCFQTQNGLSKLSVFDERVLATVITGLRMFEDVAALQADRGTIMKSVGVV
DASPDAVFEIVMSLDKSQRHQWDVLTGDLELVEHIDGHADIVYGTFDPKYFENWSWYRKY
KRRDFLISRYWRRDQDGSYLFNVRSHAAGIWEINPLPTRSGTTGSRSLVTQVMEIESTGW
GRWRKSWGKWKKSDYSSFRKTVPYILLCRTAGLREFFKAEAELSLLEDRISVLNVPKEAA
KPLETAADTEVTEDFIDAIVSEDPDAGDDTEGLISNIPFQRGSHRLSRAPWSAMLALAAA
QLENPLLADEPRINLDVNAFKGSLEPASPSKDCNCWEDPGGKGFMVRGRTYTRDNLKIPG
GEPVLKLLAVDWYKSAHRIDLVARHPQSIVRTEAGKKLPFVLIVNLQVPAKPNYSLVFYY
AADRSLRPSSLLEKFANGDDSFRNSRFKLIPSIVEGYWVVRRAVGTKACLLGRAVTCHYY
RKDNYLEVDVDIGSSSVARGVIGLVLGYVTKIVVDLAIVVEAKDDDELPEYILGTTRVNR
ISPESAVPFQLG
Download sequence
Identical sequences D8TBX9
jgi|Selmo1|431226|fgenesh2_pg.C_scaffold_148000022 XP_002993106.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]