SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|431761|fgenesh2_pg.C_scaffold_169000011 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|431761|fgenesh2_pg.C_scaffold_169000011
Domain Number 1 Region: 245-635
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.7e-93
Family Regulator of chromosome condensation RCC1 0.00041
Further Details:      
 
Domain Number 2 Region: 14-134
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-19
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 
Domain Number 3 Region: 637-703
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.53e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|431761|fgenesh2_pg.C_scaffold_169000011
Sequence length 991
Sequence
MELARCGAASLDRDVEQAIIALKKGSQLLKYGRRGRPKFAPFRLSNAWLLSSLDQDETTL
IWFSGRKERQLRLDAVTKIIPGQRTANFQRYPRPEKEYQSFSLIYGSGGEERSLDLICKD
KDEAEVWFVGLKARVSSNRTLKVDNKSEGTLSDVNSPLGRALRDSPLNSYDSFNRSPYGS
PSLFKTASTGELQSVESAKSDSLASEESLNAQGRSVSLADAFRVSMSSAVSSSSQGSGPE
DSDALGDVFIWGEGAGEGFLGGGVCKLTSGAGSRVDSLVPKALQAAVVLDVSSIACGSRH
AALVTKQGDVFCWGEEYGGRLGHGIDVDVSEPQLVQALAGVNAELVACGDFHTCAVTLSG
ELYTWGADAQSGGLVGHSNPVSHWMPKRMSSPLEGVRISSIACGAWHTALVSSAGQLFTF
GDGTFGVLGHGDKRNLAIPKEVESLKGLKTVRAACGIWHTAAVVEVIVGYSSATSCSSGK
LFTWGDGDKYRLGHGDKEQKLVPTCVAALVDYNFRQVACGHSLTVALTTSGRVFTMGSTI
YGQLGNPKADGKVPGMVDGELARTFVEEIGCGAHHVAALSSKTEIYTWGKGANGRLGHGD
VEDRTAPTLVEALRDKQVKTVACGSSFTAVICLHKPVSDADQSVCSGCKQAFGFTRKRHN
CYNCGLAYCHSCSSKKAFRASLAPNPSKAYRVCEPCLAKLERSASEEVARKSRKYMDGRE
RPLIRASKPIEMKQVGYYGNSRNTDDFAAKHQTVINIPTAIPERKAVSAKPSPPRSATPT
PTSAGLAPPGNGPDELQKKLELSRQEVLHLKTQISTLTSKYEQRERELRRGAQKVQEAVL
LAGEETAKCRAAKEVIKSLTVELKELAERMPSARRQQQRQEVPNGRHFPAPEAEIDLRLQ
TSPTSSNSATDTTVDKLVLGSGPEEWVEQDQAGVYITLALAPGGGRDLKRVRFSRRRFSE
KEAEQWWQDNRVRVHQQYSIIRTSNTSKNPT
Download sequence
Identical sequences D8TDP6
jgi|Selmo1|431761|fgenesh2_pg.C_scaffold_169000011 XP_002993711.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]