SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|437478|estExt_fgenesh2_pg.C_00584 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|437478|estExt_fgenesh2_pg.C_00584
Domain Number 1 Region: 1221-1578
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.65e-102
Family Myotubularin-like phosphatases 0.00000022
Further Details:      
 
Domain Number 2 Region: 1084-1202
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000533
Family GRAM domain 0.015
Further Details:      
 
Domain Number 3 Region: 956-1020
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.0000000000124
Family HMA, heavy metal-associated domain 0.0039
Further Details:      
 
Domain Number 4 Region: 586-698
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000243
Family PDI-like 0.013
Further Details:      
 
Domain Number 5 Region: 721-813
Classification Level Classification E-value
Superfamily VC0467-like 0.000000733
Family VC0467-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|437478|estExt_fgenesh2_pg.C_00584
Sequence length 1780
Sequence
MEFLAVLLGAIVLLRSIAGAAELQWKPLQSWGELQDHDLILCLATFPWNGEAKSFMREFL
ELLSRERPECAGNLELRIAHTHRDEQRTWMYLTLHKSGETFQYRGKLSAERVLAAVDHAL
VSELFQPLHTFGVLQEFIGSTDRAFVLVDLCGWTLETGRIVEDYENNEPKFGQPESLLYE
TANETSSCGSRRDELVFSSFYRNLTEAASASFLTPLSARFGVITLAQVLEDAGLEIPDGK
PWFLLRRTEDISRSWRVLDDPALLDDFLENTGVVVDEVDQDTQEIPRDRPSVFLFLSFSP
ELRGESIEALRIVREVARYYESSPQWKTSRNDSKVVPVVIEQDQPVMFRGVVVKNGQTIT
LGQKDLGAGIARILQLLLQGTGGKDDPETTAVVDKGTSQDITAESVHETSQGDFGAESQA
NGEDEGMQGQENSKVAQDVTMEISTEGTNEAMQEHEDMKSQEDVDEWRFNFGFFDSAYAL
QEFLTGTSNSRPSLVAVFPDRNARYVYPDDIPLSFEGLVEFLDGTLSGGVLATLKSTRAP
VVSRKAVTPPFVNRDFHRTHPVPSVSLETFPELVMGFRKGRTNSSKSSSTSLVMFTLPWC
GFCKRMELAMHEVYKYFLIQGKDDSKSVELIVPSFYQMDCGSNDCSHILANVVENQEFPS
LLLFPSKDKDKVSVYKGAPTVSGILHFIAKHGTSTVQPPSTITIQQNLDETSQEGERIGI
GHVLLATEKLSANSPNFANSAVLIVSVTDNYVVGLVMNKDMPKEELLAVDQRHNVKIGYG
GPLYTRPKYIFTFTRLQNLEGFGTVSYGLSAGANAISRRHVSVGRRAATDKHLNCRGTVA
SKFKGGSIELGHDQEQSAADHDHALQLVRAVRSQRQWIAHRGVTVEGDALGFGHEYPTDP
RLTRGAEARFFQSPVASAREWWYNRVWKEEPYDDGDDEMEDRLKDSDDTSSQYSENVVVL
KVGIHCEECKRIVGDALWAMQGVDRVDVDKLRQKVTVTGKVSTKRVLRTVQRTGKRVELW
KIGGDSKREASSSEISAAHSHHERGFVESNGRDLKYKWKLCPMKQAKQVVQAGPTVSKHG
YGLLLPGEDAIAESSGVLLVNIDRPGTLLLTSFRLVFLHGEQVCNMGTIPLATIEKFSKQ
QAVRPPGPRSSISPRRLLQIVGKDLRTIVFGFSPHVKHRRIIFDALQRLTRPARLWDLYA
FSAEWAKSCLGFDSDPRVRLQSEYERIISHHKSYWTLSDVNSDYMLCATYPSLLVMPKSL
SNEEFQQGADFRARGRLPTLSWQHPDNGAVLARSSQPLVGIMMNSRSIADEKLVAALCGR
RRKLYIVDARPRKNALANGAMGGGSESSANYSHCEVVFLGIDNIHAMRDSLGRLRDYLDT
FGASSSDGDGWDRTTQLVSLAQLMLDPYYRTFAGFQALIEKDWLAFGHPFADRLGTPTMA
SSESVRSTPAAPARPHPNPNTTSGTTYDTSPIFLQWFDCVSQLVRLYHRAFEFSGAFLVE
FMDSVLSCRFGNFLCNSEKERVQARIAESACIWTHFRRLQSVESKYNNCFYIPASRLLPS
PAALAPSLWPEYYLRWNFHPEKSSGYSLQDHIQDEIRGMFQRASSSEQGKNQAENKVQNL
MSIIDALHDELEGEKRARALAVADAIRARKETAFIKHAVETLGCEISFPSPEDLGMLETQ
LYHQRQHRHRQEQQDQSSAATNKAPDVISVSVVSGIDISARQAVKKEAQGDAKDSCNWPK
AQCPRSESAVEQIRVDYDALEQLSMDDLYFQSSLQAPRLT
Download sequence
Identical sequences D8QR58
jgi|Selmo1|437478|estExt_fgenesh2_pg.C_00584 XP_002960385.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]