SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|439246|estExt_fgenesh2_pg.C_60077 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Selmo1|439246|estExt_fgenesh2_pg.C_60077
Domain Number - Region: 24-76
Classification Level Classification E-value
Superfamily PH domain-like 0.000111
Family VPS36 N-terminal domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|439246|estExt_fgenesh2_pg.C_60077
Sequence length 203
Sequence
MKSGGLVAVPDRGGDGAPILDEAEGESFAMLQPFVGIVLGDSDAQESGTLYITTRRLVWL
SDRDISKGYAVDFLSLSMHAISRDLEAYPSPCVYCQIENGDDEYCEDDEDEEEDEVANGD
ANLSKIREMRLVPQDPAVLDNIFQVLCECAALNPDPQGEREGEGEWFFNAEEVMASENLE
RGMEGLEVQDSRFEDAEEDPEDE
Download sequence
Identical sequences D8R326
XP_002965786.1.77236 jgi|Selmo1|439246|estExt_fgenesh2_pg.C_60077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]