SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|441708|estExt_fgenesh2_pg.C_180260 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|441708|estExt_fgenesh2_pg.C_180260
Domain Number 1 Region: 53-124
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.11e-21
Family Chaperone J-domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|441708|estExt_fgenesh2_pg.C_180260
Sequence length 182
Sequence
MAVASSSANLPRFPRSGLGLSNRSSSGATRRGACVRCAYAPRGGRVALAERAAQPNFYEV
LGLSSQDVDLSSIKLAYRQMARKYHPDVCPREEMEECTQRFIVLQEAYETLSDSRRRAMY
DLAISGALDSHGIAVSWATDFEDDWRMRWADQLSGLKRRSAVKEHENRESWAARIRRQQQ
RQ
Download sequence
Identical sequences D8RL56
XP_002971939.1.77236 jgi|Selmo1|441708|estExt_fgenesh2_pg.C_180260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]