SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|442758|estExt_fgenesh2_pg.C_260282 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|442758|estExt_fgenesh2_pg.C_260282
Domain Number 1 Region: 174-367
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-31
Family BCR-homology GTPase activation domain (BH-domain) 0.0012
Further Details:      
 
Domain Number 2 Region: 8-123
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-19
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|442758|estExt_fgenesh2_pg.C_260282
Sequence length 827
Sequence
MVTPFERPRTRSNAVFKSGPLLISSKGLGWKSWKRRWFILTRTSLVFFKDDPNVLPLRGS
EASMTLGGIDLNNSGSVLVRADKKLLTVMFPDGRTVTLKAETSEDVEEWKVALERALAAA
PNAALVVGHDGIFRNDSIDVIETSTELGKDRRSVKSMVVGRPILLALEDIDGSPSFLEKA
LCFIERYGVKAEGILRQCADVEEVEHRIRDYEQGKTSFSPDEDAHVVSDCIKLVLRELPS
SPVPTPCCTALLEAYRLESKEARITSMRLAVADTFPEPNRRLLQRVLRMGRAIAAHTSDN
LMTASAVATCMAPLLLRPLIAGECGLEDDSDISGDHAAQVHAAAVAANNAQAIVTTLLEE
YDNIFEDNDQQGPPSPEMYPNLEGSESGESSEEEVLQMHETDGYHDAENDLDAQPDEDPE
RVHSGALSETSSNAGSDTFDYKAYDGKEMEKDAFGGKPLKGWSKPSHLRNENRGNEVLWE
DSGRSATTPKLDLLSARKPSSKLHASTSGSQASSRNEPVDGSADEEAAIQRLELTRSELR
AKIAKEAKGNAILQASLERRKQALHDRRLALEQDVAKLQEQLRVERELRTALESGFSLST
GGSMDSQTRAELEEIAVVEADVAELKKKVAELHIQLNQQRQQQVSLMPDTSERQQRYKSL
QSQQKILQQELDVTLALCHHERQRNDELESQTDQDASSLEHVLTQQRNALLEAKEALKAE
RVRGHDLRRRTIQQENWQALQPPSGPSARQFAWKNQNEMAAAAAAAAVAAQRHAPSPLAE
LTTRLDYFKERRSHLLEELHSLDPSLAVPLRPSESAALPPAAPVLSP
Download sequence
Identical sequences D8RVV0
XP_002975053.1.77236 jgi|Selmo1|442758|estExt_fgenesh2_pg.C_260282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]