SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|444026|estExt_fgenesh2_pg.C_390033 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|444026|estExt_fgenesh2_pg.C_390033
Domain Number 1 Region: 231-431
Classification Level Classification E-value
Superfamily VPS9 domain 3.79e-32
Family VPS9 domain 0.0026
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|444026|estExt_fgenesh2_pg.C_390033
Domain Number - Region: 16-65,98-133
Classification Level Classification E-value
Superfamily PH domain-like 0.000185
Family Pleckstrin-homology domain (PH domain) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|444026|estExt_fgenesh2_pg.C_390033
Sequence length 491
Sequence
MVTMTGEEHANWGYLWSNQMQWKHQFVAVSPGKLQVFSSEQRDHLERRIFLNGGTTVKIV
DSTESGNASLNSSSKLHFWRRISRRSSCTNQYLPEPEGAIVFIKTVQGKKMFLLVSNQHE
AGVWKTAIEQRIVLPPKHKRAQSLLRALSLTSAPSKNKSVDEASRKTRPLALRWQVGNNQ
HPADALDTREDCTAFLKSRYSNTNAFEAAMTMIEQFNGFYQMGDCQLPNELRIEAWRGTL
LSIVRNLRDQLLTRTSDLSEDHSESLWLACETWVMAAAHDKIMGACEQMYAADDRKLAQK
LSKLRQLDPSILGVNADLKDIAFGDAIQVFGMINTCRSPLEKAVCLKKTINFVMDGIQAS
SSKENQLCTDDLLSLMLLLIAHAKLQHLQATACYMENFFQMRDDQQTGELRYHITNFVAA
CAYLSSPEIEELVSSVVISPASSSSSSSSPSSSNSSSSKGGGGRSRKEIDAAFATGTSES
SPEFILAPTYL
Download sequence
Identical sequences D8S6P2
XP_002978881.1.77236 jgi|Selmo1|444026|estExt_fgenesh2_pg.C_390033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]